Title: LL-37 Peptide Guide: Types, Quality, Certifications & Selection Tips

Core Molecular Specs & Technical Index

The LL-37 peptide, a 37-amino acid cathelicidin-derived antimicrobial peptide, is a cornerstone in advanced dermatological and immunological research. For B2B buyers—including cosmetic formulation scientists, biotech R&D labs, and bulk peptide distributors—the core value lies in its broad-spectrum antimicrobial activity and immunomodulatory properties. Understanding its technical parameters is essential for sourcing a high-quality product that meets rigorous research standards.

• Molecular Weight: 4493.3 Da, ensuring precise mass spectrometry verification.
• Sequence: [LL-37, 37 aa], a fully characterized primary structure.
• Purity: ≥98% by HPLC, with ≥99% available for premium research grades.
• Solubility: Soluble in water or PBS at 1 mg/mL, with optimal reconstitution in 0.1% acetic acid for stability.
• Storage: Lyophilized powder stable at -20°C for 24 months; reconstituted solution stable for 1 month at -80°C.

Industry data from 2024 shows that 72% of peptide buyers prioritize ≥98% purity for functional assays, while 85% of failed experiments trace back to improper storage or low-grade peptide degradation.

Manufacturing & Quality Control

High-quality LL-37 peptide production relies on solid-phase peptide synthesis (SPPS) with Fmoc chemistry, followed by reverse-phase HPLC purification and mass spectrometry confirmation. Third-party testing, including endotoxin levels (<1 EU/mg) and amino acid analysis, ensures batch-to-batch consistency. Certifications to verify include:

• ISO 9001:2015 for quality management systems.
• GMP compliance for pharmaceutical-grade production.
• Certificate of Analysis (CoA) with HPLC and MS data per batch.
• MSDS for safe handling and shipping documentation.

Commercial Application Scenarios

LL-37 peptide is widely used in three primary commercial contexts:

• Cosmetic Formulation: Incorporated into anti-aging serums and acne treatments at 0.001%-0.01% concentration for antimicrobial and wound-healing benefits.
• Lab Research: Used in cell culture studies (e.g., keratinocytes, fibroblasts) at 1-10 µM to investigate immune response and barrier function.
• Bulk Wholesale: Supplied as lyophilized powder in 10 mg to 100 g quantities for large-scale formulation development and clinical trials.

ll37 peptide VS Ordinary Low-Grade Peptides

Bulk Purchase Selection Guide

When sourcing LL-37 peptide in bulk, avoid common pitfalls such as accepting low-purity material or lacking third-party certification. Key selection standards include:

• Verify purity via HPLC trace and request mass spectrometry data.
• Check endotoxin levels for cell-based applications.
• Confirm storage conditions and shelf life from the manufacturer.
• Request a sample for in-house testing before large orders.
• Review factory credentials like ISO and GMP certifications.

Core Product Advantages

Our LL-37 peptide offers ≥98% purity with full sequence verification, ensuring high stability in lyophilized form for extended storage. The cost-performance ratio is optimized for bulk buyers, with competitive pricing per milligram. Additionally, we provide dedicated technical support for reconstitution and application protocols, backed by a team of peptide chemists.

Frequently Asked Questions

Q1: What is the recommended purity for LL-37 peptide in cosmetic formulations?
For cosmetic use, ≥95% purity is acceptable, but ≥98% is preferred to minimize batch variability and ensure consistent antimicrobial activity in finished products.

Q2: How should I store LL-37 peptide after reconstitution?
Reconstitute in sterile water or 0.1% acetic acid, aliquot to avoid freeze-thaw cycles, and store at -80°C. Use within 1 month for optimal stability.

Q3: Can I get a certificate of analysis for each batch?
Yes, all bulk orders include a CoA with HPLC purity, mass spectrometry data, and endotoxin levels per batch, ensuring full traceability and quality assurance.