• Trusted Products • Industry Insights • Professional Solutions
PEPTIDESBIT.COM

Brain Natriuretic Peptide Purity Specs and Manufacturing Guide

Author: Deepa Martinez     Published: July 5, 2026 23:23

Executive Summary

Discover premium Brain Natriuretic Peptide (BNP) for research applications, engineered to meet rigorous purity specifications exceeding 98% by HPLC analysis. This manufacturing guide details our cGMP-compliant synthesis and purification processes, ensuring batch-to-batch consistency for reliable experimental outcomes. Ideal for cardiovascular and biomarker studies, our BNP eliminates common buyer pain points like lot variability and endotoxin contamination. Each product includes a comprehensive Certificate of Analysis verifying peptide content, molecular weight, and residual solvent levels. Researchers gain confidence from our transparent quality advantages: strict raw material sourcing, lyophilized formulation for stability, and third-party tested purity. Navigate the complexities of peptide procurement with a supplier prioritizing precision and documentation.

Target Keyword: brain natriuretic

Brain Natriuretic Peptide Purity Specs and Manufacturing Guide

Brain natriuretic peptide (BNP) is a 32-amino acid polypeptide hormone primarily synthesized in cardiac ventricular myocytes, recognized as a critical biomarker for cardiovascular stress and fluid volume status. For B2B buyers in the cosmetic formulation, laboratory research, and pharmaceutical raw material sectors, sourcing high-purity BNP is essential for ensuring reproducible experimental outcomes and stable product performance. The commercial value of this peptide lies in its precise molecular structure, which dictates its binding affinity and biological activity in diagnostic assays and research models. This guide provides a comprehensive overview of purity specifications, manufacturing protocols, and procurement best practices to help you make informed purchasing decisions.

Core Molecular Specs & Product Technical Index

Our brain natriuretic peptide is engineered to meet stringent technical indices that guarantee reliability in demanding applications. The peptide sequence (SPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH) is synthesized with a molecular weight of 3464.04 Da, confirmed by mass spectrometry. The product is supplied as a lyophilized powder, free from any carrier proteins or bulking agents, ensuring maximum flexibility for reconstitution in your specific buffer system.

The purity specification is the cornerstone of our quality promise. Each batch undergoes rigorous analysis to ensure purity exceeding 98% by HPLC, with a typical range of 98.5% to 99.5%. This high purity eliminates common interference from truncated or deletion sequences that can skew assay results. The peptide content is determined by amino acid analysis, typically ranging from 70% to 85% peptide by weight, with the remainder being counterions and residual moisture.

Solubility and storage are critical for maintaining peptide integrity. The lyophilized powder is freely soluble in water and common buffers at concentrations up to 1 mg/mL. For long-term stability, storage at -20°C or below is recommended, where the peptide remains stable for at least 24 months. Once reconstituted, the solution should be aliquoted and stored at -80°C to avoid freeze-thaw cycles, which can degrade the peptide over time.

  • Purity by HPLC: ≥ 98% (typically 98.5-99.5%), verified by analytical reverse-phase HPLC with UV detection at 214 nm and 280 nm.
  • Molecular Weight Confirmation: Mass spectrometry (MALDI-TOF or ESI-MS) confirms the exact mass within ± 0.5 Da of the theoretical value.
  • Peptide Content: 70-85% by weight, determined by quantitative amino acid analysis against a certified standard.
  • Residual Solvents: Below 50 ppm for acetonitrile and TFA, as measured by GC-MS, ensuring no interference in cell-based assays.
  • Endotoxin Level: Less than 1.0 EU/mg, suitable for in vitro and in vivo research applications without triggering inflammatory responses.
According to a 2023 market analysis by Grand View Research, the global peptide synthesis market is projected to reach USD 68.4 billion by 2030, with high-purity peptides (>98%) commanding a 40% price premium over standard grades due to their critical role in diagnostic and therapeutic development.

Manufacturing Flow & Strict Quality Control System

Our manufacturing process begins with rigorous raw material screening. All amino acids and coupling reagents are sourced from ISO 9001 certified suppliers and undergo identity testing by FTIR and melting point analysis before release to production. The peptide is assembled using solid-phase peptide synthesis (SPPS) on a low-substitution Wang resin, employing Fmoc chemistry to minimize racemization and deletion sequences.

After synthesis, the crude peptide is cleaved from the resin and deprotected using a standard TFA cocktail. The crude product is then subjected to multi-stage purification. The primary purification step uses preparative reverse-phase HPLC with a C18 column and a gradient of acetonitrile in 0.1% TFA. Fractions containing the target peptide are pooled based on analytical HPLC purity >95%. A second polishing purification step is performed to achieve the final purity specification of >98%. The purified peptide is then desalted using solid-phase extraction to remove residual TFA and acetonitrile.

Third-party testing certification is a mandatory step before product release. An independent, ISO 17025 accredited laboratory performs a full suite of analyses, including amino acid analysis, mass spectrometry, and endotoxin testing. The final product is lyophilized in a controlled environment to ensure consistent cake appearance and low residual moisture (<3%). Long-term stability studies are conducted at -20°C, 4°C, and 25°C for 36 months to establish shelf-life and storage recommendations.

Main Certification Standards We Support

  • Certificate of Analysis (CoA): Includes HPLC chromatogram, mass spectrum, peptide content, residual solvents, and endotoxin results for each batch.
  • Certificate of Origin: Documents the country of manufacture and raw material sourcing, essential for customs clearance and regulatory compliance.
  • Material Safety Data Sheet (MSDS): Provides handling, storage, and disposal information in accordance with GHS standards.
  • Stability Data Package: Includes accelerated and real-time stability data at multiple temperature points, supporting your own validation studies.

Main Commercial Application Scenarios

Brain natriuretic peptide is a versatile raw material with established applications across multiple B2B sectors. In cosmetic formulation, BNP is incorporated into topical serums and creams designed to support skin firmness and elasticity. The peptide's ability to modulate cellular signaling pathways makes it a valuable ingredient in anti-aging products, where it is typically used at concentrations of 0.1-1.0% in the final formulation.

In laboratory research, BNP is indispensable for cardiovascular biomarker studies. Researchers use it as a standard for ELISA and RIA assays to quantify endogenous BNP levels in patient samples. It is also employed in cell culture models to study natriuretic peptide receptor activation and downstream signaling cascades. The high purity ensures that observed effects are attributable to the peptide itself, not to contaminants.

For compound raw material wholesale, BNP is supplied in bulk quantities ranging from 100 mg to 10 grams. Wholesale buyers typically require batch-to-batch consistency for large-scale diagnostic kit manufacturing or preclinical studies. Our manufacturing process is designed to deliver this consistency, with each batch produced under the same validated protocols and tested against a reference standard.

  • Cosmetic Formulation: Anti-aging serums, firming creams, and eye treatments at 0.1-1.0% concentration, combined with hyaluronic acid and antioxidants.
  • Laboratory Research: ELISA standard curves, receptor binding assays, cell culture studies, and in vivo pharmacokinetic studies in rodent models.
  • Bulk Raw Material Supply: Diagnostic kit manufacturing, pharmaceutical development, and academic research institutions requiring gram-scale quantities.

Comparison: brain natriuretic peptide VS Ordinary Low-Grade Peptide Raw Materials

Item Our High-Purity Product Common Alternatives Advantage
Purity (HPLC) ≥ 98% (98.5-99.5% typical) 85-95% Eliminates false positives in assays; reduces lot variability
Endotoxin Level < 1.0 EU/mg 5-50 EU/mg Safe for in vivo studies; no inflammatory interference
Peptide Content 70-85% by weight 50-65% by weight Accurate dosing; less mass needed for target concentration
Batch-to-Batch Consistency CV < 5% for purity and content CV 10-20% Reproducible experimental results; reliable manufacturing
Documentation Full CoA, MSDS, stability data Basic CoA only Regulatory compliance; audit-ready documentation

Standard Buyer Selection Guide For Bulk Purchase

Purchasing brain natriuretic peptide in bulk requires careful evaluation to avoid common pitfalls. The most frequent issue is lot variability, where different batches from the same supplier show significant differences in purity or peptide content. This can compromise long-term studies or product consistency. Another common problem is inadequate documentation, leaving buyers without the necessary data for regulatory submissions or internal quality audits.

Core screening criteria should include purity specifications, endotoxin levels, and the supplier's quality management system. Verify that the supplier operates under cGMP guidelines, even if the product is for research use only. Request a sample batch for in-house testing before committing to a large order. This allows you to confirm the peptide's solubility, stability, and performance in your specific application.

Supplier qualification requires checking their manufacturing capabilities, including the scale of synthesis and purification equipment. Ask about their resin loading capacity and HPLC column specifications to ensure they can handle your required batch size. Also, verify their third-party testing partners and the frequency of their stability studies. A reliable supplier will provide a complete audit trail from raw material receipt to final product release.

Key Inspection Checklist Before Cooperation

  • Request a sample batch: Test the peptide in your specific buffer system and assay to confirm solubility and activity.
  • Review the CoA: Ensure it includes HPLC chromatogram, mass spectrum, and endotoxin results for the specific batch you are purchasing.
  • Verify manufacturing site: Confirm the facility is cGMP compliant and has appropriate environmental controls for peptide synthesis.
  • Check stability data: Request accelerated stability data at 25°C and 40°C to assess the peptide's robustness under shipping conditions.
  • Evaluate communication: Assess the supplier's technical support responsiveness and willingness to provide custom documentation.

Core Competitive Advantages Of Our brain natriuretic peptide

Our brain natriuretic peptide offers distinct advantages in purity, stability, cost performance, and technical support. The purity exceeding 98% is consistently achieved through our two-step HPLC purification process, which removes both early-eluting deletion sequences and late-eluting oxidation products. This high purity translates directly to more accurate and reproducible results in your applications, reducing the need for repeat experiments or product reformulations.

Stability is enhanced by our lyophilized formulation, which includes no excipients that could interfere with your assays. The peptide is packaged under argon in amber glass vials to protect against oxidation and light degradation. Our stability data shows less than 5% degradation after 24 months at -20°C, giving you confidence in long-term storage and usage.

Cost performance is optimized through our efficient manufacturing process. By using high-quality resins and reagents, we achieve higher crude purity, reducing the number of purification cycles needed. This efficiency is passed on to you without compromising quality. For bulk orders over 1 gram, we offer volume discounts that make our high-purity BNP competitive with lower-grade alternatives.

After-sales technical support is a key differentiator. Our team of peptide chemists and application specialists is available to help you with reconstitution protocols, assay optimization, and troubleshooting. We provide custom documentation packages for regulatory submissions, including stability summaries and method validation reports. This level of support ensures that you can integrate our BNP into your workflow with minimal friction.

Frequently Asked Questions

Q: What is the typical lead time for bulk orders of brain natriuretic peptide, and how is shipping handled to maintain stability?

A: Standard lead time for bulk orders (100 mg to 10 grams) is 10-14 business days from order confirmation, including synthesis, purification, and quality control testing. For orders exceeding 10 grams, lead time extends to 3-4 weeks due to additional purification cycles. Shipping is performed on dry ice in insulated containers to maintain the peptide at -20°C during transit. We recommend using overnight shipping for international orders to minimize time at ambient temperature. Each shipment includes a temperature data logger to verify that the cold chain was maintained.

Q: How do you ensure batch-to-batch consistency for brain natriuretic peptide, and what documentation is provided for each batch?

A: Batch-to-batch consistency is ensured through a validated manufacturing process with defined in-process controls. Each batch is synthesized using the same resin lot, reagent sources, and purification gradient. The final product is tested against a reference standard that is re-qualified annually. For each batch, we provide a comprehensive Certificate of Analysis (CoA) that includes the HPLC chromatogram overlay with the reference standard, mass spectrum, peptide content by amino acid analysis, residual solvent levels, and endotoxin results. The CoA also includes the batch number, manufacturing date, and expiry date. For customers requiring additional documentation, we can provide a stability data summary and method validation reports upon request.

Q: Can brain natriuretic peptide be customized for specific research applications, such as fluorescent labeling or specific salt forms?

A: Yes, we offer customization services for brain natriuretic peptide to meet specific research requirements. Common modifications include N-terminal fluorescent labeling with FITC, FAM, or Cy5.5 for imaging studies, and C-terminal amidation for enhanced stability. We can also provide the peptide as a TFA salt or acetate salt, depending on your buffer compatibility needs. Custom orders typically require a minimum quantity of 50 mg and have a lead time of 15-20 business days. A custom synthesis agreement is required, which includes a detailed specification sheet and a non-disclosure agreement if proprietary sequences are involved. Please contact our technical sales team with your specific requirements for a quote and feasibility assessment.